SCOPe 2.08: Domain d2vigb2: 2vig B:259-411

Lineage for d2vigb2 (2vig B:259-411)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.0: automated matches [227204] (1 protein)
   not a true family

6. Protein automated matches [226935] (30 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225243] (4 PDB entries)

8. Domain d2vigb2: 2vig B:259-411 [206365]
   Other proteins in same PDB: d2viga1, d2vigb1, d2vigc1, d2vigc3, d2vigd1, d2vigd3, d2vige1, d2vige3, d2vigf1, d2vigf3, d2vigg1, d2vigh1, d2vigh3
   automated match to d1jqia1
   complexed with cos, edo, fad

Details for d2vigb2

PDB Entry: 2vig, 1.9 Å

PDB Description: crystal structure of human short-chain acyl coa dehydrogenase

PDB Compounds: (B:) short-chain specific acyl-coa dehydrogenase,

SCOPe Domain Sequences for d2vigb2:

Sequence; same for both SEQRES and ATOM records:

>d2vigb2 a.29.3.0 (B:259-411) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgfkiamqtldmgrigiasqalgiaqtaldcavnyaenrmafgapltklqviqfkladma
lalesarlltwraamlkdnkkpfikeaamaklaaseaataishqaiqilggmgyvtempa
erhyrdariteiyegtseiqrlviaghllrsyr

Timeline for d2vigb2:

• d2vigb2 first appeared in SCOPe 2.03
  
• d2vigb2 appears in SCOPe 2.07