Class a: All alpha proteins [46456] (290 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
Protein automated matches [226935] (30 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225243] (4 PDB entries) |
Domain d2viga2: 2vig A:259-412 [206363] Other proteins in same PDB: d2viga1, d2vigb1, d2vigc1, d2vigc3, d2vigd1, d2vigd3, d2vige1, d2vige3, d2vigf1, d2vigf3, d2vigg1, d2vigh1, d2vigh3 automated match to d1jqia1 complexed with cos, edo, fad |
PDB Entry: 2vig (more details), 1.9 Å
SCOPe Domain Sequences for d2viga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2viga2 a.29.3.0 (A:259-412) automated matches {Human (Homo sapiens) [TaxId: 9606]} mgfkiamqtldmgrigiasqalgiaqtaldcavnyaenrmafgapltklqviqfkladma lalesarlltwraamlkdnkkpfikeaamaklaaseaataishqaiqilggmgyvtempa erhyrdariteiyegtseiqrlviaghllrsyrs
Timeline for d2viga2: