Lineage for d2viga1 (2vig A:34-258)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2621090Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 2621091Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 2621092Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (10 proteins)
  6. 2621182Protein automated matches [226961] (2 species)
    not a true protein
  7. 2621212Species Human (Homo sapiens) [TaxId:9606] [225392] (3 PDB entries)
  8. 2621213Domain d2viga1: 2vig A:34-258 [206362]
    Other proteins in same PDB: d2viga2, d2vigb2, d2vigc2, d2vigc3, d2vigd2, d2vigd3, d2vige2, d2vige3, d2vigf2, d2vigf3, d2vigg2, d2vigh2, d2vigh3
    automated match to d1jqia2
    complexed with cos, edo, fad

Details for d2viga1

PDB Entry: 2vig (more details), 1.9 Å

PDB Description: crystal structure of human short-chain acyl coa dehydrogenase
PDB Compounds: (A:) short-chain specific acyl-coa dehydrogenase,

SCOPe Domain Sequences for d2viga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2viga1 e.6.1.1 (A:34-258) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpethqmllqtcrdfaekelfpiaaqvdkehlfpaaqvkkmgglgllamdvpeelggagl
dylayaiameeisrgcastgvimsvnnslylgpilkfgskeqkqawvtpftsgdkigcfa
lsepgngsdagaasttaraegdswvlngtkawitnaweasaavvfastdralqnksisaf
lvpmptpgltlgkkedklgirgsstanlifedcripkdsilgepg

SCOPe Domain Coordinates for d2viga1:

Click to download the PDB-style file with coordinates for d2viga1.
(The format of our PDB-style files is described here.)

Timeline for d2viga1: