Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (10 proteins) |
Protein automated matches [226961] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225392] (3 PDB entries) |
Domain d2viga1: 2vig A:34-258 [206362] Other proteins in same PDB: d2viga2, d2vigb2, d2vigc2, d2vigc3, d2vigd2, d2vigd3, d2vige2, d2vige3, d2vigf2, d2vigf3, d2vigg2, d2vigh2, d2vigh3 automated match to d1jqia2 complexed with cos, edo, fad |
PDB Entry: 2vig (more details), 1.9 Å
SCOPe Domain Sequences for d2viga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2viga1 e.6.1.1 (A:34-258) automated matches {Human (Homo sapiens) [TaxId: 9606]} lpethqmllqtcrdfaekelfpiaaqvdkehlfpaaqvkkmgglgllamdvpeelggagl dylayaiameeisrgcastgvimsvnnslylgpilkfgskeqkqawvtpftsgdkigcfa lsepgngsdagaasttaraegdswvlngtkawitnaweasaavvfastdralqnksisaf lvpmptpgltlgkkedklgirgsstanlifedcripkdsilgepg
Timeline for d2viga1: