SCOPe 2.04: Domain d2vh9b_: 2vh9 B:

Lineage for d2vh9b_ (2vh9 B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (29 species)
   not a true protein

7. Species Tropaeolum majus [TaxId:4020] [187334] (4 PDB entries)

8. Domain d2vh9b_: 2vh9 B: [206358]
   automated match to d1umza_
   complexed with bgc, gol, zn

Details for d2vh9b_

PDB Entry: 2vh9, 2.1 Å

PDB Description: crystal structure of nxg1-deltayniig in complex with xllg, a xyloglucan derived oligosaccharide

PDB Compounds: (B:) cellulase

SCOPe Domain Sequences for d2vh9b_:

Sequence; same for both SEQRES and ATOM records:

>d2vh9b_ b.29.1.0 (B:) automated matches {Tropaeolum majus [TaxId: 4020]}
qgppspgyypssqitslgfdqgytnlwgpqhqrvdqgsltiwldstsgsgfksinryrsg
yfganiklqsgytagvitsfylsnnqdypgkhdeidieflgtipgkpytlqtnvfiegsg
dremrihlwfdptqdyhnyaiywtpseiiffvddvpirryprksdatfplrplwvygsvw
dasswatengkykadyryqpfvgkyedfklgsctveaasscnpasvspygqlsqqqvaam
ewvqknymvynycddptrdhtltpec

Timeline for d2vh9b_:

• d2vh9b_ first appeared in SCOPe 2.03
  
• d2vh9b_ appears in SCOPe 2.05
  
• d2vh9b_ appears in the current release, SCOPe 2.08