Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins) |
Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (17 PDB entries) |
Domain d1nfdb1: 1nfd B:1-117 [20635] Other proteins in same PDB: d1nfda2, d1nfdb2, d1nfdc2, d1nfdd2, d1nfde1, d1nfde2, d1nfdf1, d1nfdf2, d1nfdg1, d1nfdg2, d1nfdh1, d1nfdh2 |
PDB Entry: 1nfd (more details), 2.8 Å
SCOP Domain Sequences for d1nfdb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nfdb1 b.1.1.1 (B:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain} dsgvvqsprhiikekggrsvltcipisghsnvvwyqqtlgkelkfliqhyekverdkgfl psrfsvqqfddyhsemnmsaleledsamyfcasslrwgdeqyfgpgtrltvle
Timeline for d1nfdb1: