![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (95 species) not a true protein |
![]() | Species Synechocystis sp. [TaxId:1148] [225449] (2 PDB entries) |
![]() | Domain d2ve4b_: 2ve4 B: [206339] automated match to d3czha1 complexed with hem |
PDB Entry: 2ve4 (more details), 2.4 Å
SCOPe Domain Sequences for d2ve4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ve4b_ a.104.1.0 (B:) automated matches {Synechocystis sp. [TaxId: 1148]} lpippgdfglpwlgetlnflndgdfgkkrqqqfgpifktrlfgknvifisgalanrflft keqetfqatwplstrillgpnalatqmgeihrsrrkilyqaflprtldsylpkmdgivqg yleqwgkaneviwypqlrrmtfdvaatlfmgekvsqnpqlfpwfetyiqglfslpiplpn tlfgksqraralllaelekiikarqqqppseedalgillaarddnnqplslpelkdqill llfaghetltsalssfclllgqhsdirervrqeqnklqlsqeltaetlkkmpyldqvlqe vlrlippvgggfreliqdcqfqgfhfpkgwlvsyqisqthadpdlypdpekfdperftpd gsathnppfahvpfggglreclgkefarlemklfatrliqqfdwtllpgqnlelvvtpsp rpkdnlrvklhs
Timeline for d2ve4b_: