Class a: All alpha proteins [46456] (286 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (45 species) not a true protein |
Species Synechocystis sp. [TaxId:1148] [225449] (2 PDB entries) |
Domain d2ve4a_: 2ve4 A: [206338] automated match to d3czha1 complexed with hem |
PDB Entry: 2ve4 (more details), 2.4 Å
SCOPe Domain Sequences for d2ve4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ve4a_ a.104.1.0 (A:) automated matches {Synechocystis sp. [TaxId: 1148]} lpippgdfglpwlgetlnflndgdfgkkrqqqfgpifktrlfgknvifisgalanrflft keqetfqatwplstrillgpnalatqmgeihrsrrkilyqaflprtldsylpkmdgivqg yleqwgkaneviwypqlrrmtfdvaatlfmgekvsqnpqlfpwfetyiqglfslpiplpn tlfgksqraralllaelekiikarqqqppseedalgillaarddnnqplslpelkdqill llfaghetltsalssfclllgqhsdirervrqeqnklqlsqeltaetlkkmpyldqvlqe vlrlippvgggfreliqdcqfqgfhfpkgwlvsyqisqthadpdlypdpekfdperftpd gsathnppfahvpfggglreclgkefarlemklfatrliqqfdwtllpgqnlelvvtpsp rpkdnlrvklh
Timeline for d2ve4a_: