Lineage for d2ve4a_ (2ve4 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005975Species Synechocystis sp. [TaxId:1148] [225449] (2 PDB entries)
  8. 2005978Domain d2ve4a_: 2ve4 A: [206338]
    automated match to d3czha1
    complexed with hem

Details for d2ve4a_

PDB Entry: 2ve4 (more details), 2.4 Å

PDB Description: substrate free cyanobacterial cyp120a1
PDB Compounds: (A:) putative cytochrome p450 120

SCOPe Domain Sequences for d2ve4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ve4a_ a.104.1.0 (A:) automated matches {Synechocystis sp. [TaxId: 1148]}
lpippgdfglpwlgetlnflndgdfgkkrqqqfgpifktrlfgknvifisgalanrflft
keqetfqatwplstrillgpnalatqmgeihrsrrkilyqaflprtldsylpkmdgivqg
yleqwgkaneviwypqlrrmtfdvaatlfmgekvsqnpqlfpwfetyiqglfslpiplpn
tlfgksqraralllaelekiikarqqqppseedalgillaarddnnqplslpelkdqill
llfaghetltsalssfclllgqhsdirervrqeqnklqlsqeltaetlkkmpyldqvlqe
vlrlippvgggfreliqdcqfqgfhfpkgwlvsyqisqthadpdlypdpekfdperftpd
gsathnppfahvpfggglreclgkefarlemklfatrliqqfdwtllpgqnlelvvtpsp
rpkdnlrvklh

SCOPe Domain Coordinates for d2ve4a_:

Click to download the PDB-style file with coordinates for d2ve4a_.
(The format of our PDB-style files is described here.)

Timeline for d2ve4a_: