Lineage for d2ve3b_ (2ve3 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005975Species Synechocystis sp. [TaxId:1148] [225449] (2 PDB entries)
  8. 2005977Domain d2ve3b_: 2ve3 B: [206337]
    automated match to d3czha1
    complexed with hem, rea

Details for d2ve3b_

PDB Entry: 2ve3 (more details), 2.1 Å

PDB Description: retinoic acid bound cyanobacterial cyp120a1
PDB Compounds: (B:) putative cytochrome p450 120

SCOPe Domain Sequences for d2ve3b_:

Sequence, based on SEQRES records: (download)

>d2ve3b_ a.104.1.0 (B:) automated matches {Synechocystis sp. [TaxId: 1148]}
slpippgdfglpwlgetlnflndgdfgkkrqqqfgpifktrlfgknvifisgalanrflf
tkeqetfqatwplstrillgpnalatqmgeihrsrrkilyqaflprtldsylpkmdgivq
gyleqwgkaneviwypqlrrmtfdvaatlfmgekvsqnpqlfpwfetyiqglfslpiplp
ntlfgksqraralllaelekiikarqqqppseedalgillaarddnnqplslpelkdqil
lllfaghetltsalssfclllgqhsdirervrqeqnklqlsqeltaetlkkmpyldqvlq
evlrlippvgggfreliqdcqfqgfhfpkgwlvsyqisqthadpdlypdpekfdperftp
dgsathnppfahvpfggglreclgkefarlemklfatrliqqfdwtllpgqnlelvvtps
prpkdnlrvklhsl

Sequence, based on observed residues (ATOM records): (download)

>d2ve3b_ a.104.1.0 (B:) automated matches {Synechocystis sp. [TaxId: 1148]}
slpippgdfglpwlgetlnflndgdfgkkrqqqfgpifktrlfgknvifisgalanrflf
tkeqetfqatwplstrillgpnalatqmgeihrsrrkilyqaflprtldsylpkmdgivq
gyleqwgkaneviwypqlrrmtfdvaatlfmgeknpqlfpwfetyiqglfslpiplpntl
fgksqraralllaelekiikarqqqppseedalgillaarddnnqplslpelkdqillll
faghetltsalssfclllgqhsdirervrqeqnkleltaetlkkmpyldqvlqevlrlip
pvgggfreliqdcqfqgfhfpkgwlvsyqisqthadpdlypdpekfdperftpdgsathn
ppfahvpfggglreclgkefarlemklfatrliqqfdwtllpgqnlelvvtpsprpkdnl
rvklhsl

SCOPe Domain Coordinates for d2ve3b_:

Click to download the PDB-style file with coordinates for d2ve3b_.
(The format of our PDB-style files is described here.)

Timeline for d2ve3b_: