Lineage for d2vd3b1 (2vd3 B:-1-212)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2522523Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2522524Protein automated matches [190039] (158 species)
    not a true protein
  7. 2523063Species Methanobacterium thermoautotrophicum [TaxId:187420] [225549] (1 PDB entry)
  8. 2523065Domain d2vd3b1: 2vd3 B:-1-212 [206334]
    Other proteins in same PDB: d2vd3a2, d2vd3b2
    automated match to d1h3da1
    complexed with cl, his, imd, mg, mpd, mrd

Details for d2vd3b1

PDB Entry: 2vd3 (more details), 2.45 Å

PDB Description: the structure of histidine inhibited hisg from methanobacterium thermoautotrophicum
PDB Compounds: (B:) ATP phosphoribosyltransferase

SCOPe Domain Sequences for d2vd3b1:

Sequence, based on SEQRES records: (download)

>d2vd3b1 c.94.1.0 (B:-1-212) automated matches {Methanobacterium thermoautotrophicum [TaxId: 187420]}
avpkiriavpskgrisepairllenagvglkdtvnrklfsktqhpqievmfsraadipef
vadgaadlgitgydlivergsdveiledlkygraslvlaapedstirgpediprgaviat
efpgitenylrehgidaevveltgsteiapfigvadlitdlsstgttlrmnhlrvidtil
essvklianresyatksgiieelrtgirgvidae

Sequence, based on observed residues (ATOM records): (download)

>d2vd3b1 c.94.1.0 (B:-1-212) automated matches {Methanobacterium thermoautotrophicum [TaxId: 187420]}
avpkiriavpskgrisepairllenagvglkdtvrklfsktqhpqievmfsraadipefv
adgaadlgitgydlivergsdveiledlkygraslvlaapedstirgpediprgaviate
fpgitenylrehgidaevveltgsteiapfigvadlitdlsstgttlrmnhlrvidtile
ssvklianresyatksgiieelrtgirgvidae

SCOPe Domain Coordinates for d2vd3b1:

Click to download the PDB-style file with coordinates for d2vd3b1.
(The format of our PDB-style files is described here.)

Timeline for d2vd3b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vd3b2