SCOPe 2.05: Domain d2vd3b1: 2vd3 B:-1-212

Lineage for d2vd3b1 (2vd3 B:-1-212)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (120 species)
   not a true protein

7. Species Methanobacterium thermoautotrophicum [TaxId:187420] [225549] (1 PDB entry)

8. Domain d2vd3b1: 2vd3 B:-1-212 [206334]
   Other proteins in same PDB: d2vd3a2, d2vd3b2
   automated match to d1h3da1
   complexed with cl, his, imd, mg, mpd, mrd

Details for d2vd3b1

PDB Entry: 2vd3, 2.45 Å

PDB Description: the structure of histidine inhibited hisg from methanobacterium thermoautotrophicum

PDB Compounds: (B:) ATP phosphoribosyltransferase

SCOPe Domain Sequences for d2vd3b1:

Sequence, based on SEQRES records:

>d2vd3b1 c.94.1.0 (B:-1-212) automated matches {Methanobacterium thermoautotrophicum [TaxId: 187420]}
avpkiriavpskgrisepairllenagvglkdtvnrklfsktqhpqievmfsraadipef
vadgaadlgitgydlivergsdveiledlkygraslvlaapedstirgpediprgaviat
efpgitenylrehgidaevveltgsteiapfigvadlitdlsstgttlrmnhlrvidtil
essvklianresyatksgiieelrtgirgvidae

Sequence, based on observed residues (ATOM records):

>d2vd3b1 c.94.1.0 (B:-1-212) automated matches {Methanobacterium thermoautotrophicum [TaxId: 187420]}
avpkiriavpskgrisepairllenagvglkdtvrklfsktqhpqievmfsraadipefv
adgaadlgitgydlivergsdveiledlkygraslvlaapedstirgpediprgaviate
fpgitenylrehgidaevveltgsteiapfigvadlitdlsstgttlrmnhlrvidtile
ssvklianresyatksgiieelrtgirgvidae

Timeline for d2vd3b1:

• d2vd3b1 first appeared in SCOPe 2.03
  
• d2vd3b1 appears in SCOPe 2.04
  
• d2vd3b1 appears in SCOPe 2.06
  
• d2vd3b1 appears in the current release, SCOPe 2.08