| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) ![]() form timeric structures with the orthogonally packed beta-sheets |
| Family d.58.5.0: automated matches [191474] (1 protein) not a true family |
| Protein automated matches [190753] (21 species) not a true protein |
| Species Methanobacterium thermoautotrophicum [TaxId:187420] [225550] (1 PDB entry) |
| Domain d2vd3a2: 2vd3 A:213-287 [206333] Other proteins in same PDB: d2vd3a1, d2vd3b1 automated match to d1h3da2 complexed with cl, his, imd, mg, mpd, mrd |
PDB Entry: 2vd3 (more details), 2.45 Å
SCOPe Domain Sequences for d2vd3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vd3a2 d.58.5.0 (A:213-287) automated matches {Methanobacterium thermoautotrophicum [TaxId: 187420]}
gkrlvmlnidrknldrvralmpgmtgptvsevlsdngvvavhavvdekevfnlinrlkav
gardilvvpieriip
Timeline for d2vd3a2: