Lineage for d2vcvl1 (2vcv L:4-80)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133854Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2133855Protein automated matches [190056] (165 species)
    not a true protein
  7. 2134369Species Human (Homo sapiens) [TaxId:9606] [188013] (106 PDB entries)
  8. 2134453Domain d2vcvl1: 2vcv L:4-80 [206322]
    Other proteins in same PDB: d2vcva2, d2vcvb2, d2vcvc2, d2vcvd2, d2vcve2, d2vcvf2, d2vcvg2, d2vcvh2, d2vcvi2, d2vcvj2, d2vcvk2, d2vcvl2, d2vcvm2, d2vcvn2, d2vcvo2, d2vcvp2
    automated match to d1k3ya2
    complexed with asd, gsh

Details for d2vcvl1

PDB Entry: 2vcv (more details), 1.8 Å

PDB Description: glutathione transferase a3-3 in complex with glutathione and delta-4- androstene-3-17-dione
PDB Compounds: (L:) glutathione s-transferase a3

SCOPe Domain Sequences for d2vcvl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vcvl1 c.47.1.0 (L:4-80) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kpklhyfngrgrmepirwllaaagvefeekfigsaedlgklrndgslmfqqvpmveidgm
klvqtrailnyiaskyn

SCOPe Domain Coordinates for d2vcvl1:

Click to download the PDB-style file with coordinates for d2vcvl1.
(The format of our PDB-style files is described here.)

Timeline for d2vcvl1: