Lineage for d1fo0b_ (1fo0 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2354864Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 2355009Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (28 PDB entries)
  8. 2355041Domain d1fo0b_: 1fo0 B: [20631]
    Other proteins in same PDB: d1fo0h1, d1fo0h2, d1fo0l_

Details for d1fo0b_

PDB Entry: 1fo0 (more details), 2.5 Å

PDB Description: murine alloreactive scfv tcr-peptide-mhc class i molecule complex
PDB Compounds: (B:) protein (bm3.3 t cell receptor beta-chain)

SCOPe Domain Sequences for d1fo0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fo0b_ b.1.1.1 (B:) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
vtlleqnprwrlvprgqavnlrcilknsqypwmswyqqdlqkqlqwlftlrspgdkevks
lpgadylatrvtdtelrlqvanmsqgrtlyctcsadrvgntlyfgegsrliv

SCOPe Domain Coordinates for d1fo0b_:

Click to download the PDB-style file with coordinates for d1fo0b_.
(The format of our PDB-style files is described here.)

Timeline for d1fo0b_: