SCOP 1.59: Domain d1fo0b_: 1fo0 B:

Lineage for d1fo0b_ (1fo0 B:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)

7. Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (11 PDB entries)

8. Domain d1fo0b_: 1fo0 B: [20631]
   Other proteins in same PDB: d1fo0h1, d1fo0h2, d1fo0l1

Details for d1fo0b_

PDB Entry: 1fo0, 2.5 Å

PDB Description: murine alloreactive scfv tcr-peptide-mhc class i molecule complex

SCOP Domain Sequences for d1fo0b_:

Sequence; same for both SEQRES and ATOM records:

>d1fo0b_ b.1.1.1 (B:) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
vtlleqnprwrlvprgqavnlrcilknsqypwmswyqqdlqkqlqwlftlrspgdkevks
lpgadylatrvtdtelrlqvanmsqgrtlyctcsadrvgntlyfgegsrliv

Timeline for d1fo0b_:

• d1fo0b_ first appeared (with stable ids) in SCOP 1.55
  
• d1fo0b_ appears in SCOP 1.57
  
• d1fo0b_ appears in SCOP 1.61
  
• d1fo0b_ appears in the current release, SCOPe 2.08