Lineage for d1fo0b_ (1fo0 B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 8110Protein T-cell antigen receptor [48933] (5 species)
  7. 8145Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (11 PDB entries)
  8. 8150Domain d1fo0b_: 1fo0 B: [20631]
    Other proteins in same PDB: d1fo0h1, d1fo0h2, d1fo0l1

Details for d1fo0b_

PDB Entry: 1fo0 (more details), 2.5 Å

PDB Description: murine alloreactive scfv tcr-peptide-mhc class i molecule complex

SCOP Domain Sequences for d1fo0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fo0b_ b.1.1.1 (B:) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
vtlleqnprwrlvprgqavnlrcilknsqypwmswyqqdlqkqlqwlftlrspgdkevks
lpgadylatrvtdtelrlqvanmsqgrtlyctcsadrvgntlyfgegsrliv

SCOP Domain Coordinates for d1fo0b_:

Click to download the PDB-style file with coordinates for d1fo0b_.
(The format of our PDB-style files is described here.)

Timeline for d1fo0b_: