Lineage for d1tcrb1 (1tcr B:1-117)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 931485Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 931624Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (27 PDB entries)
  8. 931641Domain d1tcrb1: 1tcr B:1-117 [20630]
    Other proteins in same PDB: d1tcra2, d1tcrb2
    complexed with nag, so4

Details for d1tcrb1

PDB Entry: 1tcr (more details), 2.5 Å

PDB Description: murine t-cell antigen receptor 2c clone
PDB Compounds: (B:) alpha, beta T-cell receptor (vb8.2db2jb2.4cb2;va3ja58ca)

SCOPe Domain Sequences for d1tcrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tcrb1 b.1.1.1 (B:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
eaavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdi
pdgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvle

SCOPe Domain Coordinates for d1tcrb1:

Click to download the PDB-style file with coordinates for d1tcrb1.
(The format of our PDB-style files is described here.)

Timeline for d1tcrb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tcrb2