Lineage for d1tcrb1 (1tcr B:1-117)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 103212Protein T-cell antigen receptor [48933] (6 species)
  7. 103261Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (11 PDB entries)
  8. 103265Domain d1tcrb1: 1tcr B:1-117 [20630]
    Other proteins in same PDB: d1tcra2, d1tcrb2

Details for d1tcrb1

PDB Entry: 1tcr (more details), 2.5 Å

PDB Description: murine t-cell antigen receptor 2c clone

SCOP Domain Sequences for d1tcrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tcrb1 b.1.1.1 (B:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
eaavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdi
pdgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvle

SCOP Domain Coordinates for d1tcrb1:

Click to download the PDB-style file with coordinates for d1tcrb1.
(The format of our PDB-style files is described here.)

Timeline for d1tcrb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tcrb2