SCOP 1.59: Domain d1tcrb1: 1tcr B:1-117

Lineage for d1tcrb1 (1tcr B:1-117)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)

7. Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (11 PDB entries)

8. Domain d1tcrb1: 1tcr B:1-117 [20630]
   Other proteins in same PDB: d1tcra2, d1tcrb2

Details for d1tcrb1

PDB Entry: 1tcr, 2.5 Å

PDB Description: murine t-cell antigen receptor 2c clone

SCOP Domain Sequences for d1tcrb1:

Sequence; same for both SEQRES and ATOM records:

>d1tcrb1 b.1.1.1 (B:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
eaavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdi
pdgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvle

Timeline for d1tcrb1:

• d1tcrb1 first appeared (with stable ids) in SCOP 1.55
  
• d1tcrb1 appears in SCOP 1.57
  
• d1tcrb1 appears in SCOP 1.61
  
• d1tcrb1 appears in the current release, SCOPe 2.08