| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
| Protein automated matches [226848] (14 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [224956] (38 PDB entries) |
| Domain d2vcth2: 2vct H:81-222 [206299] Other proteins in same PDB: d2vcta1, d2vctb1, d2vctc1, d2vctd1, d2vcte1, d2vctf1, d2vctg1, d2vcth1 automated match to d1agsa1 complexed with asd |
PDB Entry: 2vct (more details), 2.1 Å
SCOPe Domain Sequences for d2vcth2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vcth2 a.45.1.1 (H:81-222) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lygkdikekalidmyiegiadlgemilllpftqpeeqdaklaliqektknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleesrkifrf
Timeline for d2vcth2: