SCOPe 2.07: Domain d2vctg1: 2vct G:2-80

Lineage for d2vctg1 (2vct G:2-80)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (188 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries)

8. Domain d2vctg1: 2vct G:2-80 [206296]
   Other proteins in same PDB: d2vcta2, d2vctb2, d2vctc2, d2vctd2, d2vcte2, d2vctf2, d2vctg2, d2vcth2
   automated match to d1k3ya2
   complexed with asd

Details for d2vctg1

PDB Entry: 2vct, 2.1 Å

PDB Description: glutathione transferase a2-2 in complex with delta-4-andostrene-3-17- dione

PDB Compounds: (G:) glutathione s-transferase a2

SCOPe Domain Sequences for d2vctg1:

Sequence; same for both SEQRES and ATOM records:

>d2vctg1 c.47.1.0 (G:2-80) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
gmklvqtrailnyiaskyn

Timeline for d2vctg1:

• d2vctg1 first appeared in SCOPe 2.03
  
• d2vctg1 appears in SCOPe 2.06
  
• d2vctg1 appears in the current release, SCOPe 2.08