Lineage for d2vctd2 (2vct D:81-222)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1491601Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1491602Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1491603Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1492203Protein automated matches [226848] (10 species)
    not a true protein
  7. 1492217Species Human (Homo sapiens) [TaxId:9606] [224956] (35 PDB entries)
  8. 1492295Domain d2vctd2: 2vct D:81-222 [206291]
    Other proteins in same PDB: d2vcta1, d2vctb1, d2vctc1, d2vctd1, d2vcte1, d2vctf1, d2vctg1, d2vcth1
    automated match to d1agsa1
    complexed with asd

Details for d2vctd2

PDB Entry: 2vct (more details), 2.1 Å

PDB Description: glutathione transferase a2-2 in complex with delta-4-andostrene-3-17- dione
PDB Compounds: (D:) glutathione s-transferase a2

SCOPe Domain Sequences for d2vctd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vctd2 a.45.1.1 (D:81-222) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lygkdikekalidmyiegiadlgemilllpftqpeeqdaklaliqektknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleesrkifrf

SCOPe Domain Coordinates for d2vctd2:

Click to download the PDB-style file with coordinates for d2vctd2.
(The format of our PDB-style files is described here.)

Timeline for d2vctd2: