SCOP 1.55: Domain d1sbbc1: 1sbb C:3-117

Lineage for d1sbbc1 (1sbb C:3-117)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein T-cell antigen receptor [48933] (5 species)

7. Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (11 PDB entries)

8. Domain d1sbbc1: 1sbb C:3-117 [20629]
   Other proteins in same PDB: d1sbba2, d1sbbb1, d1sbbb2, d1sbbc2, d1sbbd1, d1sbbd2

Details for d1sbbc1

PDB Entry: 1sbb, 2.4 Å

PDB Description: t-cell receptor beta chain complexed with superantigen seb

SCOP Domain Sequences for d1sbbc1:

Sequence; same for both SEQRES and ATOM records:

>d1sbbc1 b.1.1.1 (C:3-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
avtqsprnkvavtggkvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqeqfslilelatpsqtsvyfcasgggrgsyaeqffgpgtrltvle

Timeline for d1sbbc1:

• d1sbbc1 appears in SCOP 1.57
  
• d1sbbc1 appears in the current release, SCOPe 2.08