| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries) |
| Domain d2vcta1: 2vct A:2-80 [206284] Other proteins in same PDB: d2vcta2, d2vctb2, d2vctc2, d2vctd2, d2vcte2, d2vctf2, d2vctg2, d2vcth2 automated match to d1k3ya2 complexed with asd |
PDB Entry: 2vct (more details), 2.1 Å
SCOPe Domain Sequences for d2vcta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vcta1 c.47.1.0 (A:2-80) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
gmklvqtrailnyiaskyn
Timeline for d2vcta1: