Lineage for d2vama1 (2vam A:12-208)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1361112Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1361113Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 1361297Family c.32.1.0: automated matches [227136] (1 protein)
    not a true family
  6. 1361298Protein automated matches [226838] (3 species)
    not a true protein
  7. 1361299Species Bacillus subtilis [TaxId:1423] [225338] (2 PDB entries)
  8. 1361301Domain d2vama1: 2vam A:12-208 [206282]
    Other proteins in same PDB: d2vama2
    automated match to d1rq2a1
    complexed with so4

Details for d2vama1

PDB Entry: 2vam (more details), 2.5 Å

PDB Description: ftsz b. subtilis
PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d2vama1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vama1 c.32.1.0 (A:12-208) automated matches {Bacillus subtilis [TaxId: 1423]}
asikvigvggggnnavnrmienevqgveyiavntdaqalnlskaevkmqigakltrglga
ganpevgkkaaeeskeqieealkgadmvfvtagmgggtgtgaapviaqiakdlgaltvgv
vtrpftfegrkrqlqaaggisamkeavdtlivipndrileivdkntpmleafreadnvlr
qgvqgisdliatpglin

SCOPe Domain Coordinates for d2vama1:

Click to download the PDB-style file with coordinates for d2vama1.
(The format of our PDB-style files is described here.)

Timeline for d2vama1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vama2