SCOP 1.59: Domain d1sbba1: 1sbb A:3-117

Lineage for d1sbba1 (1sbb A:3-117)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)

7. Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (11 PDB entries)

8. Domain d1sbba1: 1sbb A:3-117 [20628]
   Other proteins in same PDB: d1sbba2, d1sbbb1, d1sbbb2, d1sbbc2, d1sbbd1, d1sbbd2

Details for d1sbba1

PDB Entry: 1sbb, 2.4 Å

PDB Description: t-cell receptor beta chain complexed with superantigen seb

SCOP Domain Sequences for d1sbba1:

Sequence; same for both SEQRES and ATOM records:

>d1sbba1 b.1.1.1 (A:3-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
avtqsprnkvavtggkvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqeqfslilelatpsqtsvyfcasgggrgsyaeqffgpgtrltvle

Timeline for d1sbba1:

• d1sbba1 first appeared (with stable ids) in SCOP 1.55
  
• d1sbba1 appears in SCOP 1.57
  
• d1sbba1 appears in SCOP 1.61
  
• d1sbba1 appears in the current release, SCOPe 2.08