SCOPe 2.06: Domain d2v9yb1: 2v9y B:475-599

Lineage for d2v9yb1 (2v9y B:475-599)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families)

5. Family d.79.4.0: automated matches [227181] (1 protein)
   not a true family

6. Protein automated matches [226901] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225335] (1 PDB entry)

8. Domain d2v9yb1: 2v9y B:475-599 [206274]
   Other proteins in same PDB: d2v9ya2, d2v9yb2
   automated match to d1clia1
   complexed with so4

Details for d2v9yb1

PDB Entry: 2v9y, 2.1 Å

PDB Description: human aminoimidazole ribonucleotide synthetase

PDB Compounds: (B:) phosphoribosylformylglycinamidine cyclo-ligase

SCOPe Domain Sequences for d2v9yb1:

Sequence; same for both SEQRES and ATOM records:

>d2v9yb1 d.79.4.0 (B:475-599) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glfdlkaagfkdpllasgtdgvgtklkiaqlcnkhdtigqdlvamcvndilaqgaeplff
ldyfscgkldlsvteavvagiakacgkagcallggetaempdmyppgeydlagfavgame
rdqkl

Timeline for d2v9yb1:

• d2v9yb1 first appeared in SCOPe 2.03
  
• d2v9yb1 appears in SCOPe 2.05
  
• d2v9yb1 appears in SCOPe 2.07
  
• d2v9yb1 appears in the current release, SCOPe 2.08