SCOP 1.61: Domain d1qsfd1: 1qsf D:1-117

Lineage for d1qsfd1 (1qsf D:1-117)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)

7. Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (7 PDB entries)

8. Domain d1qsfd1: 1qsf D:1-117 [20626]
   Other proteins in same PDB: d1qsfa1, d1qsfa2, d1qsfb1, d1qsfd2, d1qsfe2

Details for d1qsfd1

PDB Entry: 1qsf, 2.8 Å

PDB Description: structure of a6-tcr bound to hla-a2 complexed with altered htlv-1 tax peptide y8a

SCOP Domain Sequences for d1qsfd1:

Sequence; same for both SEQRES and ATOM records:

>d1qsfd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain}
keveqnsgplsvpegaiaslnctysdrgsqsffwyrqysgkspelimsiysngdkedgrf
taqlnkasqyvsllirdsqpsdsatylcavttdswgklqfgagtqvvvtpd

Timeline for d1qsfd1:

• d1qsfd1 first appeared (with stable ids) in SCOP 1.55
  
• d1qsfd1 appears in SCOP 1.59
  
• d1qsfd1 appears in SCOP 1.63
  
• d1qsfd1 appears in the current release, SCOPe 2.08