SCOPe 2.08: Domain d2v6mb1: 2v6m B:22-164

Lineage for d2v6mb1 (2v6m B:22-164)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [187989] (16 PDB entries)

8. Domain d2v6mb1: 2v6m B:22-164 [206253]
   Other proteins in same PDB: d2v6ma2, d2v6mb2, d2v6mc2, d2v6md2
   automated match to d1llda1
   complexed with mes

Details for d2v6mb1

PDB Entry: 2v6m, 2.2 Å

PDB Description: crystal structure of lactate dehydrogenase from thermus thermophilus hb8 (apo form)

PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2v6mb1:

Sequence, based on SEQRES records:

>d2v6mb1 c.2.1.0 (B:22-164) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
vmtqvayrlsglppgrvvgsg

Sequence, based on observed residues (ATOM records):

>d2v6mb1 c.2.1.0 (B:22-164) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
sygdlegaravvlaagvrlqlldrnaqvfaqvvprvleaapeavllvatnpvdvmtqvay
rlsglppgrvvgsg

Timeline for d2v6mb1:

• d2v6mb1 first appeared in SCOPe 2.03
  
• d2v6mb1 appears in SCOPe 2.07