SCOPe 2.07: Domain d2v6kb2: 2v6k B:80-212

Lineage for d2v6kb2 (2v6k B:80-212)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (65 species)
   not a true protein

7. Species Ralstonia sp. [TaxId:70356] [225493] (2 PDB entries)

8. Domain d2v6kb2: 2v6k B:80-212 [206250]
   Other proteins in same PDB: d2v6ka1, d2v6kb1
   automated match to d1e6ba1
   complexed with act, na, tgg

Details for d2v6kb2

PDB Entry: 2v6k, 1.3 Å

PDB Description: structure of maleyl pyruvate isomerase, a bacterial glutathione-s- transferase in zeta class, in complex with substrate analogue dicarboxyethyl glutathione

PDB Compounds: (B:) maleylpyruvate isomerase

SCOPe Domain Sequences for d2v6kb2:

Sequence; same for both SEQRES and ATOM records:

>d2v6kb2 a.45.1.0 (B:80-212) automated matches {Ralstonia sp. [TaxId: 70356]}
allpadadgrqrvralaaivgcdihpinnrrileylrktfgadeaainawcgtwisagfd
ayeallavdpkrgrysfgdtptladcylvpqvesarrfqvdltpypliravdaacgelda
frraapaaqpdsa

Timeline for d2v6kb2:

• d2v6kb2 first appeared in SCOPe 2.03
  
• d2v6kb2 appears in SCOPe 2.06