| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
| Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (17 PDB entries) |
| Domain d1qsed1: 1qse D:1-117 [20625] Other proteins in same PDB: d1qsea1, d1qsea2, d1qseb_, d1qsed2, d1qsee2 |
PDB Entry: 1qse (more details), 2.8 Å
SCOPe Domain Sequences for d1qsed1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qsed1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
keveqnsgplsvpegaiaslnctysdrgsqsffwyrqysgkspelimsiysngdkedgrf
taqlnkasqyvsllirdsqpsdsatylcavttdswgklqfgagtqvvvtpd
Timeline for d1qsed1: