Lineage for d1qsed1 (1qse D:1-117)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) 
Protein T-cell antigen receptor [48933] (5 species) 
Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (6 PDB entries) 
Domain d1qsed1: 1qse D:1-117 [20625]
Other proteins in same PDB: d1qsea1, d1qsea2, d1qseb1, d1qsed2, d1qsee2
Details for d1qsed1
PDB Entry: 1qse (more details), 2.8 Å
PDB Description: structure of human a6-tcr bound to hla-a2 complexed with altered htlv- 1 tax peptide v7r
SCOP Domain Sequences for d1qsed1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qsed1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain}
keveqnsgplsvpegaiaslnctysdrgsqsffwyrqysgkspelimsiysngdkedgrf
taqlnkasqyvsllirdsqpsdsatylcavttdswgklqfgagtqvvvtpd
SCOP Domain Coordinates for d1qsed1:
Click to download the PDB-style file with coordinates for d1qsed1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qsed1:
- d1qsed1 appears in SCOP 1.57
- d1qsed1 appears in the current release, SCOPe 2.08
View in 3D
