Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (61 species) not a true protein |
Species Ralstonia sp. [TaxId:70356] [225493] (2 PDB entries) |
Domain d2v6ka2: 2v6k A:80-212 [206248] Other proteins in same PDB: d2v6ka1, d2v6kb1 automated match to d1e6ba1 complexed with act, na, tgg |
PDB Entry: 2v6k (more details), 1.3 Å
SCOPe Domain Sequences for d2v6ka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v6ka2 a.45.1.0 (A:80-212) automated matches {Ralstonia sp. [TaxId: 70356]} allpadadgrqrvralaaivgcdihpinnrrileylrktfgadeaainawcgtwisagfd ayeallavdpkrgrysfgdtptladcylvpqvesarrfqvdltpypliravdaacgelda frraapaaqpdsa
Timeline for d2v6ka2: