Lineage for d2v6ka2 (2v6k A:80-212)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998814Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1998815Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1999700Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 1999701Protein automated matches [226831] (61 species)
    not a true protein
  7. 2000093Species Ralstonia sp. [TaxId:70356] [225493] (2 PDB entries)
  8. 2000094Domain d2v6ka2: 2v6k A:80-212 [206248]
    Other proteins in same PDB: d2v6ka1, d2v6kb1
    automated match to d1e6ba1
    complexed with act, na, tgg

Details for d2v6ka2

PDB Entry: 2v6k (more details), 1.3 Å

PDB Description: structure of maleyl pyruvate isomerase, a bacterial glutathione-s- transferase in zeta class, in complex with substrate analogue dicarboxyethyl glutathione
PDB Compounds: (A:) maleylpyruvate isomerase

SCOPe Domain Sequences for d2v6ka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v6ka2 a.45.1.0 (A:80-212) automated matches {Ralstonia sp. [TaxId: 70356]}
allpadadgrqrvralaaivgcdihpinnrrileylrktfgadeaainawcgtwisagfd
ayeallavdpkrgrysfgdtptladcylvpqvesarrfqvdltpypliravdaacgelda
frraapaaqpdsa

SCOPe Domain Coordinates for d2v6ka2:

Click to download the PDB-style file with coordinates for d2v6ka2.
(The format of our PDB-style files is described here.)

Timeline for d2v6ka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2v6ka1