SCOPe 2.05: Domain d2v6ka1: 2v6k A:-1-79

Lineage for d2v6ka1 (2v6k A:-1-79)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (147 species)
   not a true protein

7. Species Ralstonia sp. [TaxId:70356] [225492] (2 PDB entries)

8. Domain d2v6ka1: 2v6k A:-1-79 [206247]
   Other proteins in same PDB: d2v6ka2, d2v6kb2
   automated match to d1e6ba2
   complexed with act, na, tgg

Details for d2v6ka1

PDB Entry: 2v6k, 1.3 Å

PDB Description: structure of maleyl pyruvate isomerase, a bacterial glutathione-s- transferase in zeta class, in complex with substrate analogue dicarboxyethyl glutathione

PDB Compounds: (A:) maleylpyruvate isomerase

SCOPe Domain Sequences for d2v6ka1:

Sequence; same for both SEQRES and ATOM records:

>d2v6ka1 c.47.1.0 (A:-1-79) automated matches {Ralstonia sp. [TaxId: 70356]}
akmklynfwrsgtshrlrialnlkgvpyeylavhlgkeehlkdafkalnpqqlvpaldtg
aqvliqspaiiewleeqyptp

Timeline for d2v6ka1:

• d2v6ka1 first appeared in SCOPe 2.03
  
• d2v6ka1 appears in SCOPe 2.04
  
• d2v6ka1 appears in SCOPe 2.06
  
• d2v6ka1 appears in the current release, SCOPe 2.08