SCOP 1.57: Domain d1qrnd1: 1qrn D:1-117

Lineage for d1qrnd1 (1qrn D:1-117)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)

7. Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (6 PDB entries)

8. Domain d1qrnd1: 1qrn D:1-117 [20624]
   Other proteins in same PDB: d1qrna1, d1qrna2, d1qrnb1, d1qrnd2, d1qrne2

Details for d1qrnd1

PDB Entry: 1qrn, 2.8 Å

PDB Description: crystal structure of human a6 tcr complexed with hla-a2 bound to altered htlv-1 tax peptide p6a

SCOP Domain Sequences for d1qrnd1:

Sequence; same for both SEQRES and ATOM records:

>d1qrnd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain}
keveqnsgplsvpegaiaslnctysdrgsqsffwyrqysgkspelimsiysngdkedgrf
taqlnkasqyvsllirdsqpsdsatylcavttdswgklqfgagtqvvvtpd

Timeline for d1qrnd1:

• d1qrnd1 first appeared (with stable ids) in SCOP 1.55
  
• d1qrnd1 appears in SCOP 1.59
  
• d1qrnd1 appears in the current release, SCOPe 2.08