Lineage for d2v65b2 (2v65 B:163-331)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2999522Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2999523Protein automated matches [226850] (47 species)
    not a true protein
  7. 2999601Species Champsocephalus gunnari [TaxId:52237] [225332] (1 PDB entry)
  8. 2999603Domain d2v65b2: 2v65 B:163-331 [206238]
    Other proteins in same PDB: d2v65a1, d2v65b1
    automated match to d9ldta2

Details for d2v65b2

PDB Entry: 2v65 (more details), 2.35 Å

PDB Description: apo ldh from the psychrophile c. gunnari
PDB Compounds: (B:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d2v65b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v65b2 d.162.1.0 (B:163-331) automated matches {Champsocephalus gunnari [TaxId: 52237]}
sgtnldsarfrhligeklhlhpsschawivgehgdssvpvwsgvnvagvslqglnpqmgt
egdgenwkaihkevvdgayeviklkgytswaigmsvadlvesiiknmhkvhpvstlvqgm
hgvkdevflsvpcvlgnsgltdvihmtlkaeeekqlqksaetlwgvqkeltl

SCOPe Domain Coordinates for d2v65b2:

Click to download the PDB-style file with coordinates for d2v65b2.
(The format of our PDB-style files is described here.)

Timeline for d2v65b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2v65b1