SCOPe 2.07: Domain d2v5cb3: 2v5c B:496-624

Lineage for d2v5cb3 (2v5c B:496-624)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies)
   5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology

4. Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (2 families)

5. Family a.246.1.1: Hyaluronidase post-catalytic domain-like [140658] (2 proteins)

6. Protein Hyaluronidase, post-catalytic domain 3 [140659] (1 species)

7. Species Clostridium perfringens [TaxId:1502] [140660] (7 PDB entries)
   Uniprot Q8XL08 496-624

8. Domain d2v5cb3: 2v5c B:496-624 [206234]
   Other proteins in same PDB: d2v5ca1, d2v5ca2, d2v5cb1, d2v5cb2
   automated match to d2cbia1
   complexed with ca, cac, na

Details for d2v5cb3

PDB Entry: 2v5c, 2.1 Å

PDB Description: family 84 glycoside hydrolase from clostridium perfringens, 2.1 angstrom structure

PDB Compounds: (B:) O-GlcNAcase nagJ

SCOPe Domain Sequences for d2v5cb3:

Sequence; same for both SEQRES and ATOM records:

>d2v5cb3 a.246.1.1 (B:496-624) Hyaluronidase, post-catalytic domain 3 {Clostridium perfringens [TaxId: 1502]}
edapelrakmdelwnklsskedasalieelygefarmeeacnnlkanlpevaleecsrql
delitlaqgdkasldmivaqlnedteayesakeiaqnklntalssfavisekvaqsfiqe
alsfdltli

Timeline for d2v5cb3:

• d2v5cb3 first appeared in SCOPe 2.03
  
• d2v5cb3 appears in SCOPe 2.06
  
• d2v5cb3 appears in the current release, SCOPe 2.08