Lineage for d2v5cb1 (2v5c B:41-178)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2965096Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 2965167Family d.92.2.3: Hyaluronidase N-terminal domain-like [143618] (2 proteins)
  6. 2965182Protein Hyaluronidase N-terminal domain [143619] (1 species)
  7. 2965183Species Clostridium perfringens [TaxId:1502] [143620] (7 PDB entries)
    Uniprot Q8XL08 41-178
  8. 2965185Domain d2v5cb1: 2v5c B:41-178 [206232]
    Other proteins in same PDB: d2v5ca2, d2v5ca3, d2v5cb2, d2v5cb3
    automated match to d2cbia3
    complexed with ca, cac, na

Details for d2v5cb1

PDB Entry: 2v5c (more details), 2.1 Å

PDB Description: family 84 glycoside hydrolase from clostridium perfringens, 2.1 angstrom structure
PDB Compounds: (B:) O-GlcNAcase nagJ

SCOPe Domain Sequences for d2v5cb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v5cb1 d.92.2.3 (B:41-178) Hyaluronidase N-terminal domain {Clostridium perfringens [TaxId: 1502]}
vlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltannieinsendpn
sttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgdgtfygvqtfk
qlvkesnipevnitdypt

SCOPe Domain Coordinates for d2v5cb1:

Click to download the PDB-style file with coordinates for d2v5cb1.
(The format of our PDB-style files is described here.)

Timeline for d2v5cb1: