SCOPe 2.02: Domain d1ao7d_: 1ao7 D:

Lineage for d1ao7d_ (1ao7 D:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (17 PDB entries)

8. Domain d1ao7d_: 1ao7 D: [20623]
   Other proteins in same PDB: d1ao7a1, d1ao7a2, d1ao7b_, d1ao7e2
   C-domain not seen in the crystal structure, due to disorder
   complexed with emc

Details for d1ao7d_

PDB Entry: 1ao7, 2.6 Å

PDB Description: complex between human t-cell receptor, viral peptide (tax), and hla-a 0201

PDB Compounds: (D:) t cell receptor alpha

SCOPe Domain Sequences for d1ao7d_:

Sequence; same for both SEQRES and ATOM records:

>d1ao7d_ b.1.1.1 (D:) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
keveqnsgplsvpegaiaslnctysdrgsqsffwyrqysgkspelimsiysngdkedgrf
taqlnkasqyvsllirdsqpsdsatylcavttdswgklqfgagtqvvvtpdiqnp

Timeline for d1ao7d_:

• d1ao7d_ first appeared (with stable ids) in SCOP 1.55
  
• d1ao7d_ appears in SCOPe 2.01
  
• d1ao7d_ appears in SCOPe 2.03
  
• d1ao7d_ appears in the current release, SCOPe 2.08