Lineage for d1ao7d_ (1ao7 D:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) 
Protein T-cell antigen receptor [48933] (5 species) 
Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (6 PDB entries) 
Domain d1ao7d_: 1ao7 D: [20623]
Other proteins in same PDB: d1ao7a1, d1ao7a2, d1ao7b1, d1ao7e2
Details for d1ao7d_
PDB Entry: 1ao7 (more details), 2.6 Å
PDB Description: complex between human t-cell receptor, viral peptide (tax), and hla-a 0201
SCOP Domain Sequences for d1ao7d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ao7d_ b.1.1.1 (D:) T-cell antigen receptor {Human (Homo sapiens), alpha-chain}
keveqnsgplsvpegaiaslnctysdrgsqsffwyrqysgkspelimsiysngdkedgrf
taqlnkasqyvsllirdsqpsdsatylcavttdswgklqfgagtqvvvtpdiqnp
SCOP Domain Coordinates for d1ao7d_:
Click to download the PDB-style file with coordinates for d1ao7d_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ao7d_:
- d1ao7d_ appears in SCOP 1.57
- d1ao7d_ appears in the current release, SCOPe 2.08
View in 3D
