Lineage for d2v5ab3 (2v5a B:331-446)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1560127Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 1560230Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 1560231Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
    probable rudiment form of the biotinyl-carrier domain
  6. 1560238Protein Biotin carboxylase (BC), C-domain [51248] (2 species)
    subunit of acetyl-CoA and pyruvate carboxylases
  7. 1560241Species Escherichia coli [TaxId:562] [51249] (24 PDB entries)
  8. 1560274Domain d2v5ab3: 2v5a B:331-446 [206228]
    Other proteins in same PDB: d2v5aa1, d2v5aa2, d2v5ab1, d2v5ab2
    automated match to d1dv1a1
    complexed with cl, lzl

Details for d2v5ab3

PDB Entry: 2v5a (more details), 2.31 Å

PDB Description: crystal structure of biotin carboxylase from e.coli in complex with potent inhibitor 3
PDB Compounds: (B:) biotin carboxylase

SCOPe Domain Sequences for d2v5ab3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v5ab3 b.84.2.1 (B:331-446) Biotin carboxylase (BC), C-domain {Escherichia coli [TaxId: 562]}
rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic
ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekklgl

SCOPe Domain Coordinates for d2v5ab3:

Click to download the PDB-style file with coordinates for d2v5ab3.
(The format of our PDB-style files is described here.)

Timeline for d2v5ab3: