Lineage for d2v59a2 (2v59 A:115-330)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2217268Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2217269Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2217297Family d.142.1.2: BC ATP-binding domain-like [56067] (7 proteins)
  6. 2217304Protein Biotin carboxylase (BC), domain 2 [56068] (2 species)
    subunit of acetyl-CoA and pyruvate carboxylases
  7. 2217307Species Escherichia coli [TaxId:562] [56069] (24 PDB entries)
  8. 2217342Domain d2v59a2: 2v59 A:115-330 [206218]
    Other proteins in same PDB: d2v59a1, d2v59a3, d2v59b1, d2v59b3
    automated match to d1dv1a3
    complexed with lzk

Details for d2v59a2

PDB Entry: 2v59 (more details), 2.4 Å

PDB Description: crystal structure of biotin carboxylase from e.coli in complex with potent inhibitor 2
PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d2v59a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v59a2 d.142.1.2 (A:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]}
dkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrg
daelaqsismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqr
rhqkvveeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriq
vehpvtemitgvdlikeqlriaagqplsikqeevhv

SCOPe Domain Coordinates for d2v59a2:

Click to download the PDB-style file with coordinates for d2v59a2.
(The format of our PDB-style files is described here.)

Timeline for d2v59a2: