SCOPe 2.05: Domain d2v59a1: 2v59 A:1-114

Lineage for d2v59a1 (2v59 A:1-114)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (9 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)

6. Protein Biotin carboxylase (BC), N-terminal domain [52442] (2 species)
   subunit of acetyl-CoA and pyruvate carboxylases

7. Species Escherichia coli [TaxId:562] [52443] (24 PDB entries)

8. Domain d2v59a1: 2v59 A:1-114 [206217]
   Other proteins in same PDB: d2v59a2, d2v59a3, d2v59b2, d2v59b3
   automated match to d1dv1a2
   complexed with lzk

Details for d2v59a1

PDB Entry: 2v59, 2.4 Å

PDB Description: crystal structure of biotin carboxylase from e.coli in complex with potent inhibitor 2

PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d2v59a1:

Sequence; same for both SEQRES and ATOM records:

>d2v59a1 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-terminal domain {Escherichia coli [TaxId: 562]}
mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmg

Timeline for d2v59a1:

• d2v59a1 first appeared in SCOPe 2.03
  
• d2v59a1 appears in SCOPe 2.04
  
• d2v59a1 appears in SCOPe 2.06
  
• d2v59a1 appears in the current release, SCOPe 2.08