Lineage for d2v58b2 (2v58 B:115-330)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1928430Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1928431Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) (S)
  5. 1928459Family d.142.1.2: BC ATP-binding domain-like [56067] (7 proteins)
  6. 1928466Protein Biotin carboxylase (BC), domain 2 [56068] (2 species)
    subunit of acetyl-CoA and pyruvate carboxylases
  7. 1928469Species Escherichia coli [TaxId:562] [56069] (24 PDB entries)
  8. 1928492Domain d2v58b2: 2v58 B:115-330 [206215]
    Other proteins in same PDB: d2v58a1, d2v58a3, d2v58b1, d2v58b3
    automated match to d1dv1a3
    complexed with cl, lzj

Details for d2v58b2

PDB Entry: 2v58 (more details), 2.1 Å

PDB Description: crystal structure of biotin carboxylase from e.coli in complex with potent inhibitor 1
PDB Compounds: (B:) biotin carboxylase

SCOPe Domain Sequences for d2v58b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v58b2 d.142.1.2 (B:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]}
dkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrg
daelaqsismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqr
rhqkvveeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriq
vehpvtemitgvdlikeqlriaagqplsikqeevhv

SCOPe Domain Coordinates for d2v58b2:

Click to download the PDB-style file with coordinates for d2v58b2.
(The format of our PDB-style files is described here.)

Timeline for d2v58b2: