SCOP 1.61: Domain d1fytd1: 1fyt D:1-117

Lineage for d1fytd1 (1fyt D:1-117)

Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
Superfamily b.1.1: Immunoglobulin [48726] (6 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
Protein T-cell antigen receptor [48933] (6 species)
Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (7 PDB entries)
Domain d1fytd1: 1fyt D:1-117 [20621]
Other proteins in same PDB: d1fyta1, d1fyta2, d1fytb1, d1fytb2, d1fytd2, d1fyte2

Details for d1fytd1

PDB Entry: 1fyt (more details), 2.6 Å

PDB Description: crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr1

SCOP Domain Sequences for d1fytd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fytd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain}
qsvtqlgshvsvsegalvllrcnysssvppylfwyvqypnqglqlllkytsaatlvkgin
gfeaefkksetsfhltkpsahmsdaaeyfcavsespfgnekltfgtgtrltiipn

SCOP Domain Coordinates for d1fytd1:

Click to download the PDB-style file with coordinates for d1fytd1.
(The format of our PDB-style files is described here.)

Timeline for d1fytd1: