Lineage for d2v40a_ (2v40 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111791Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 protein domains)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2112083Protein automated matches [190304] (11 species)
    not a true protein
  7. 2112095Species Human (Homo sapiens) [TaxId:9606] [189076] (3 PDB entries)
  8. 2112096Domain d2v40a_: 2v40 A: [206202]
    automated match to d1j4ba_
    complexed with gdp

Details for d2v40a_

PDB Entry: 2v40 (more details), 1.9 Å

PDB Description: human adenylosuccinate synthetase isozyme 2 in complex with gdp
PDB Compounds: (A:) adenylosuccinate synthetase isozyme 2

SCOPe Domain Sequences for d2v40a_:

Sequence, based on SEQRES records: (download)

>d2v40a_ c.37.1.10 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggnrvtvvlgaqwgdegkgkvvdllaqdadivcrcqggnnaghtvvvdsveydfhllpsg
iinpnvtafigngvvihlpglfeeaeknvqkgkglegwekrliisdrahivfdfhqaadg
iqeqqrqeqagknlgttkkgigpvysskaarsglrmcdlvsdfdgfserfkvlanqyksi
yptleidiegelqklkgymekikpmvrdgvyflyealhgppkkilveganaalldidfgt
ypfvtssnctvggvctglgmppqnvgevygvvkayttrvgigafpteqdneigellqtrg
refgvttgrkrrcgwldlvllkyahmingftalaltkldildmfteikvgvaykldgeii
phipanqevlnkvevqyktlpgwntdisnarafkelpvnaqnyvrfiedelqipvkwigv
gksresmiqlf

Sequence, based on observed residues (ATOM records): (download)

>d2v40a_ c.37.1.10 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggnrvtvvlgaqwgdegkgkvvdllaqdadivcrcqggnnaghtvvvdsveydfhllpsg
iinpnvtafigngvvihlpglfeeaeknvqkgkglegwekrliisdrahivfdfhqaadg
iqeqqkkgigpvysskaarsglrmcdlvsdfdgfserfkvlanqyksiyptleidiegel
qklkgymekikpmvrdgvyflyealhgppkkilveganaalldidfgtypfvtssnctvg
gvctglgmppqnvgevygvvkayttrvgigafpteqdneigellqtrgrefgvttgrkrr
cgwldlvllkyahmingftalaltkldildmfteikvgvaykldgeiiphipanqevlnk
vevqyktlpgwntdisnarafkelpvnaqnyvrfiedelqipvkwigvgksresmiqlf

SCOPe Domain Coordinates for d2v40a_:

Click to download the PDB-style file with coordinates for d2v40a_.
(The format of our PDB-style files is described here.)

Timeline for d2v40a_: