Lineage for d2v24a_ (2v24 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780523Family b.29.1.22: SPRY domain [141154] (6 proteins)
    Pfam PF00622
  6. 2780548Protein automated matches [190921] (2 species)
    not a true protein
  7. 2780549Species Human (Homo sapiens) [TaxId:9606] [225298] (1 PDB entry)
  8. 2780550Domain d2v24a_: 2v24 A: [206200]
    automated match to d2ihsa1
    complexed with ni

Details for d2v24a_

PDB Entry: 2v24 (more details), 2.2 Å

PDB Description: structure of the human spry domain-containing socs box protein ssb-4
PDB Compounds: (A:) spry domain-containing socs box protein 4

SCOPe Domain Sequences for d2v24a_:

Sequence, based on SEQRES records: (download)

>d2v24a_ b.29.1.22 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rparldqlldmpaaglavqlrhawnpedrslnvfvkdddrltfhrhpvaqstdgirgkvg
harglhawqinwparqrgthavvgvataraplhsvgytalvgsdaeswgwdlgrsrlyhd
gknqpgvaypaflgpdeafalpdsllvvldmdegtlsfivdgqylgvafrglkgkklypv
vsavwghcevtmryingldpe

Sequence, based on observed residues (ATOM records): (download)

>d2v24a_ b.29.1.22 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rparldqlldmpaaglavqlrhawnpedrslnvfvkdddrltfhrhpvaqstdgirgkvg
harglhawqinwparqrgthavvgvataraplhsvgytalvgsdaeswgwdlgrsrlyhd
pgvaypaflgpdeafalpdsllvvldmdegtlsfivdgqylgvafrglkgkklypvvsav
wghcevtmryingldpe

SCOPe Domain Coordinates for d2v24a_:

Click to download the PDB-style file with coordinates for d2v24a_.
(The format of our PDB-style files is described here.)

Timeline for d2v24a_: