Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (22 PDB entries) |
Domain d1bwma1: 1bwm A:301-417 [20620] single-chain construct of beta and alpha N-domains connected by a 27-residue linker |
PDB Entry: 1bwm (more details)
SCOPe Domain Sequences for d1bwma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bwma1 b.1.1.1 (A:301-417) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} qqqvrqspqsltvwegettilncsyedstfdyfpwyrqfpgkspalliaislvsnkkedg rftiffnkrekklslhitdsqpgdsatyfcaatgsfnkltfgagtrlavspy
Timeline for d1bwma1: