SCOP 1.59: Domain d1bwma1: 1bwm A:301-417

Lineage for d1bwma1 (1bwm A:301-417)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)

7. Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (12 PDB entries)

8. Domain d1bwma1: 1bwm A:301-417 [20620]

Details for d1bwma1

PDB Entry: 1bwm

PDB Description: a single-chain t cell receptor

SCOP Domain Sequences for d1bwma1:

Sequence; same for both SEQRES and ATOM records:

>d1bwma1 b.1.1.1 (A:301-417) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain}
qqqvrqspqsltvwegettilncsyedstfdyfpwyrqfpgkspalliaislvsnkkedg
rftiffnkrekklslhitdsqpgdsatyfcaatgsfnkltfgagtrlavspy

Timeline for d1bwma1:

• d1bwma1 first appeared (with stable ids) in SCOP 1.55
  
• d1bwma1 appears in SCOP 1.57
  
• d1bwma1 appears in SCOP 1.61
  
• d1bwma1 appears in the current release, SCOPe 2.08