Lineage for d1bwma1 (1bwm A:301-417)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2741896Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 2742002Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (22 PDB entries)
  8. 2742040Domain d1bwma1: 1bwm A:301-417 [20620]
    single-chain construct of beta and alpha N-domains connected by a 27-residue linker

Details for d1bwma1

PDB Entry: 1bwm (more details)

PDB Description: a single-chain t cell receptor
PDB Compounds: (A:) protein (alpha-beta t cell receptor (tcr) (d10))

SCOPe Domain Sequences for d1bwma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bwma1 b.1.1.1 (A:301-417) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
qqqvrqspqsltvwegettilncsyedstfdyfpwyrqfpgkspalliaislvsnkkedg
rftiffnkrekklslhitdsqpgdsatyfcaatgsfnkltfgagtrlavspy

SCOPe Domain Coordinates for d1bwma1:

Click to download the PDB-style file with coordinates for d1bwma1.
(The format of our PDB-style files is described here.)

Timeline for d1bwma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bwma2