Lineage for d2v20a1 (2v20 A:1-268)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2618349Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2618350Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2618351Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2619196Protein automated matches [190161] (30 species)
    not a true protein
  7. 2619286Species Escherichia coli [TaxId:562] [187306] (106 PDB entries)
  8. 2619368Domain d2v20a1: 2v20 A:1-268 [206199]
    Other proteins in same PDB: d2v20a2
    automated match to d1jtda_
    complexed with so4, zn

Details for d2v20a1

PDB Entry: 2v20 (more details), 1.67 Å

PDB Description: structure of a tem-1 beta-lactamase insertant allosterically regulated by kanamycin and anions. complex with sulfate.
PDB Compounds: (A:) Beta-lactamase TEM

SCOPe Domain Sequences for d2v20a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v20a1 e.3.1.1 (A:1-268) automated matches {Escherichia coli [TaxId: 562]}
petlvkvkdaedqlcrtshrpcrvgyieldlnsgkilesfrpeerfpmmstfkvllcgav
lsridagqeqlgrrihysqndlvkyspvtekhltdgmtvrelcsaaitmsdntaanlllt
tiggpkeltaflhnmgdhvtrldrwepelneaipnderdttmpvamattlrklltgellt
lasrqqlidwmeadkvagpllrsalpagwfiadksgagrrgsrgiiaalgpdgkpsrivv
iyttgsrkktdernrqiaeigaslikhw

SCOPe Domain Coordinates for d2v20a1:

Click to download the PDB-style file with coordinates for d2v20a1.
(The format of our PDB-style files is described here.)

Timeline for d2v20a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2v20a2